PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Carubv10000964m
Common NameCARUB_v10000964mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Capsella
Family EIL
Protein Properties Length: 444aa    MW: 50622.6 Da    PI: 5.1744
Description EIL family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Carubv10000964mgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1EIN3388.41.1e-118242721258
                      XXXXXXXXXXXXXXXXXXXXXXX..XXXXX.XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX CS
             EIN3   1 eelkkrmwkdqmllkrlkerkkqlledkeaatgakksnksneqarrkkmsraQDgiLkYMlkemevcnaqGfvYgiipekgkpvegasdsLraW 94 
                      ++lk+rmwkd++l+++lk++k +    +++ ++   s ++ e++rrkkm+r+QD++LkYM+k+mevc+a+GfvYgi+pekgkp +g+sdsLr+W
  Carubv10000964m  24 DDLKRRMWKDRNLMEKLKQQKGHY---NDV-VS--LSTHRAEASRRKKMARSQDSVLKYMMKIMEVCKAKGFVYGIVPEKGKPITGSSDSLRRW 111
                      79*****************99984...454.33..35689****************************************************** PP

                      XXXXXXXXXXXXXXXXXX...XXXXXXXXXXXXX....XX----STTS-HHHHHHHHHHHSSSSSS-TTS--TTT--HHHH---S--HHHHHHT CS
             EIN3  95 Wkekvefdrngpaaisky...qaknlilsgesslqtersseshslselqDTtlgSLLsalmqhcdppqrrfplekgvepPWWPtGkelwwgelg 185
                      Wke+v+f++n+p ai++y   +a++li +   s   ++ss  h+l++lqDTtlgSLLsalmqhc+ppqrrfplekg++pPWWPtG+elwwge+g
  Carubv10000964m 112 WKENVQFEQNAPDAITEYltlAAAELIDK---S---SSSSFLHMLQDLQDTTLGSLLSALMQHCMPPQRRFPLEKGIAPPWWPTGSELWWGEQG 199
                      ******************87777777743...2...25789***************************************************** PP

                      --TT--.-----GGG--HHHHHHHHHHHHHHTGGGHHHHHHTTTTSSSSTTT--SHHHHHHHHHHTTTTT-S- CS
             EIN3 186 lskdqgtppykkphdlkkawkvsvLtavikhmsptieeirelerqskylqdkmsakesfallsvlnqeekeca 258
                      +++++g+ppy+kphdl+k wkvsvL+avikhmsp++ ++r+l+rqsk+lqdkm+ake++++++vlnqee++++
  Carubv10000964m 200 AAHEHGAPPYRKPHDLRKSWKVSVLAAVIKHMSPNLGRVRRLARQSKSLQDKMMAKETDTWSRVLNQEEALLN 272
                      *********************************************************************9874 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF048735.6E-11724268No hitNo description
Gene3DG3DSA:1.10.3180.101.4E-67141272IPR023278Ethylene insensitive 3-like protein, DNA-binding domain
SuperFamilySSF1167686.41E-59147271IPR023278Ethylene insensitive 3-like protein, DNA-binding domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0080167Biological Processresponse to karrikin
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 444 aa     Download sequence    Send to blast
MVEVEELETL SPTEDEEEEE ISYDDLKRRM WKDRNLMEKL KQQKGHYNDV VSLSTHRAEA  60
SRRKKMARSQ DSVLKYMMKI MEVCKAKGFV YGIVPEKGKP ITGSSDSLRR WWKENVQFEQ  120
NAPDAITEYL TLAAAELIDK SSSSSFLHML QDLQDTTLGS LLSALMQHCM PPQRRFPLEK  180
GIAPPWWPTG SELWWGEQGA AHEHGAPPYR KPHDLRKSWK VSVLAAVIKH MSPNLGRVRR  240
LARQSKSLQD KMMAKETDTW SRVLNQEEAL LNIQDLKISE DRDQEASGSK RKGELMEPSK  300
SVYTCQNSSC PKSDVSFGFG DKNSRTGHQI QCLYGSTQEL SQSMGDITSM LETTPSIVTN  360
STSEDDYHSV SSTAMDKRDD DHHIINGNWM DYFWLEKMQN ELHCSRSIED DDNDGTGTDL  420
NQFSESDQSD NVNQSTFSVW DMV*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4zds_A2e-571482704126Protein ETHYLENE INSENSITIVE 3
4zds_B2e-571482704126Protein ETHYLENE INSENSITIVE 3
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAL3563320.0AL356332.1 Arabidopsis thaliana DNA chromosome 5, BAC clone T31P16 (ESSA project).
GenBankCP0026880.0CP002688.1 Arabidopsis thaliana chromosome 5 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006287753.10.0hypothetical protein CARUB_v10000964mg
SwissprotQ9LX160.0EIL4_ARATH; Putative ETHYLENE INSENSITIVE 3-like 4 protein
TrEMBLR0FFE30.0R0FFE3_9BRAS; Uncharacterized protein
STRINGfgenesh2_kg.6__972__AT5G10120.10.0(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM58792747
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G10120.10.0EIL family protein